PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK26697.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family NF-YC
Protein Properties Length: 183aa    MW: 20011.6 Da    PI: 4.2106
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK26697.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC1504.8e-4714108297
       NF-YC   2 lksfwekqiekatdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivp 97 
                 l+ +w +q+e+  d+++h+lPlarikki+k+d+dv+mi+aeaP++++kace+fi++lt+rsw haee+krrtl ksdi++a  r+  fdfl+d+vp
  KFK26697.1  14 LQDYWCSQMES-VDLRRHQLPLARIKKIMKSDPDVHMIAAEAPIVFAKACEMFIIDLTMRSWAHAEESKRRTLLKSDITTAAYRSYAFDFLIDVVP 108
                 899******97.59*********************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471134.02E-279103IPR009072Histone-fold
PfamPF008081.2E-193193IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.101.4E-3232108IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MQPPLENPER NQELQDYWCS QMESVDLRRH QLPLARIKKI MKSDPDVHMI AAEAPIVFAK  60
ACEMFIIDLT MRSWAHAEES KRRTLLKSDI TTAAYRSYAF DFLIDVVPGP DPAVVADQGF  120
MPGAGESNCY PPGIETGFPG VDVSVMYPPP QQACPVAQPE TTADGGEEEA EPSGGTSSVD  180
LGV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_C8e-361410819118HapE
4g92_C8e-361410819118HapE
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006402087.12e-54hypothetical protein EUTSA_v10015323mg
SwissprotQ9FGP72e-53NFYC6_ARATH; Nuclear transcription factor Y subunit C-6
TrEMBLA0A087G9Z51e-135A0A087G9Z5_ARAAL; Uncharacterized protein
STRINGAT5G50480.14e-51(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM47828160
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50480.17e-47nuclear factor Y, subunit C6